SCOPe 2.03: Domain d4j4ed_: 4j4e D:

Lineage for d4j4ed_ (4j4e D:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.89: Cyanovirin-N [51321] (1 superfamily)
   complex fold

4. Superfamily b.89.1: Cyanovirin-N [51322] (1 family)
   duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
   automatically mapped to Pfam PF08881

5. Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)

6. Protein Cyanovirin-N [51324] (1 species)

7. Species Nostoc ellipsosporum [TaxId:45916] [51325] (16 PDB entries)

8. Domain d4j4ed_: 4j4e D: [223544]
   automated match to d4j4db_

Details for d4j4ed_

PDB Entry: 4j4e, 2.4 Å

PDB Description: Structure of P51G Cyanovirin-N swapped trimer in the P212121 space group

PDB Compounds: (D:) Cyanovirin-N

SCOPe Domain Sequences for d4j4ed_:

Sequence; same for both SEQRES and ATOM records:

>d4j4ed_ b.89.1.1 (D:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

Timeline for d4j4ed_:

• d4j4ed_ is new in SCOPe 2.03-stable
  
• d4j4ed_ appears in SCOPe 2.04
  
• d4j4ed_ appears in the current release, SCOPe 2.08