PDB entry 4j4e

View 4j4e on RCSB PDB site
Description: Structure of P51G Cyanovirin-N swapped trimer in the P212121 space group
Class: sugar binding protein
Keywords: CVNH fold, carbohydrate binding protein, antiviral protein, SUGAR BINDING PROTEIN
Deposited on 2013-02-06, released 2013-04-03
The last revision prior to the SCOPe 2.03 freeze date was dated 2013-05-22, with a file datestamp of 2013-05-17.
Experiment type: XRAY
Resolution: 2.4 Å
R-factor: 0.239
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.03: d4j4ea_
  • Chain 'B':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.03: d4j4eb_
  • Chain 'C':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.03: d4j4ec_
  • Chain 'D':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.03: d4j4ed_
  • Chain 'E':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.03: d4j4ee_
  • Chain 'F':
    Compound: Cyanovirin-N
    Species: Nostoc ellipsosporum [TaxId:45916]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P81180 (0-100)
      • engineered mutation (50)
    Domains in SCOPe 2.03: d4j4ef_
  • Heterogens: HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4eA (A:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4eB (B:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

  • Chain 'C':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4eC (C:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

  • Chain 'D':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4eD (D:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

  • Chain 'E':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4eE (E:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

  • Chain 'F':
    Sequence; same for both SEQRES and ATOM records: (download) 
    >4j4eF (F:)
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye