Class b: All beta proteins [48724] (174 folds) |
Fold b.89: Cyanovirin-N [51321] (1 superfamily) complex fold |
Superfamily b.89.1: Cyanovirin-N [51322] (1 family) duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins automatically mapped to Pfam PF08881 |
Family b.89.1.1: Cyanovirin-N [51323] (2 proteins) |
Protein Cyanovirin-N [51324] (1 species) |
Species Nostoc ellipsosporum [TaxId:45916] [51325] (16 PDB entries) |
Domain d4j4db_: 4j4d B: [193103] automated match to d3ezma_ |
PDB Entry: 4j4d (more details), 2 Å
SCOPe Domain Sequences for d4j4db_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4j4db_ b.89.1.1 (B:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]} lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn tqlagsselaaecktraqqfvstkinlddhianidgtlkye
Timeline for d4j4db_: