SCOPe 2.03: Domain d4j4dc_: 4j4d C:

Lineage for d4j4dc_ (4j4d C:)

1. Root: SCOPe 2.03

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.89: Cyanovirin-N [51321] (1 superfamily)
   complex fold

4. Superfamily b.89.1: Cyanovirin-N [51322] (1 family)
   duplication: tandem repeat of two homologous motifs made three stranded beta-sheet and beta-hairpins
   automatically mapped to Pfam PF08881

5. Family b.89.1.1: Cyanovirin-N [51323] (2 proteins)

6. Protein Cyanovirin-N [51324] (1 species)

7. Species Nostoc ellipsosporum [TaxId:45916] [51325] (16 PDB entries)

8. Domain d4j4dc_: 4j4d C: [193106]
   automated match to d3ezma_

Details for d4j4dc_

PDB Entry: 4j4d, 2 Å

PDB Description: Structure of P51G Cyanovirin-N swapped dimer in the P21212 space group

PDB Compounds: (C:) Cyanovirin-N

SCOPe Domain Sequences for d4j4dc_:

Sequence; same for both SEQRES and ATOM records:

>d4j4dc_ b.89.1.1 (C:) Cyanovirin-N {Nostoc ellipsosporum [TaxId: 45916]}
lgkfsqtcynsaiqgsvltstcertnggyntssidlnsvienvdgslkwqgsnfietcrn
tqlagsselaaecktraqqfvstkinlddhianidgtlkye

Timeline for d4j4dc_:

• d4j4dc_ first appeared in SCOPe 2.02
  
• d4j4dc_ appears in SCOPe 2.04
  
• d4j4dc_ appears in the current release, SCOPe 2.08