Lineage for d1kbpb1 (1kbp B:9-120)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2374702Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 2374703Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 2374704Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)
  7. Species French bean (Phaseolus vulgaris) [TaxId:3885] [49366] (3 PDB entries)
  8. 2374707Domain d1kbpb1: 1kbp B:9-120 [22350]
    Other proteins in same PDB: d1kbpa2, d1kbpb2, d1kbpc2, d1kbpd2
    complexed with fe, nag, zn

Details for d1kbpb1

PDB Entry: 1kbp (more details), 2.65 Å

PDB Description: kidney bean purple acid phosphatase
PDB Compounds: (B:) purple acid phosphatase

SCOPe Domain Sequences for d1kbpb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbpb1 b.1.12.1 (B:9-120) Purple acid phosphatase, N-terminal domain {French bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d1kbpb1:

Click to download the PDB-style file with coordinates for d1kbpb1.
(The format of our PDB-style files is described here.)

Timeline for d1kbpb1: