![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
![]() | Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) |
![]() | Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) |
![]() | Domain d1kbpb1: 1kbp B:9-120 [22350] Other proteins in same PDB: d1kbpa2, d1kbpb2, d1kbpc2, d1kbpd2 complexed with fe, nag, zn |
PDB Entry: 1kbp (more details), 2.65 Å
SCOPe Domain Sequences for d1kbpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbpb1 b.1.12.1 (B:9-120) Purple acid phosphatase, N-terminal domain {French bean (Phaseolus vulgaris) [TaxId: 3885]} rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d1kbpb1: