| Class b: All beta proteins [48724] (174 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) ![]() |
| Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein) |
| Protein Purple acid phosphatase, N-terminal domain [49365] (2 species) |
| Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (5 PDB entries) |
| Domain d1kbpb1: 1kbp B:9-120 [22350] Other proteins in same PDB: d1kbpa2, d1kbpb2, d1kbpc2, d1kbpd2 complexed with fe, nag, zn |
PDB Entry: 1kbp (more details), 2.65 Å
SCOPe Domain Sequences for d1kbpb1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1kbpb1 b.1.12.1 (B:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp
Timeline for d1kbpb1: