Lineage for d1kbpa1 (1kbp A:9-120)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1287433Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1299191Superfamily b.1.12: Purple acid phosphatase, N-terminal domain [49363] (2 families) (S)
  5. 1299192Family b.1.12.1: Purple acid phosphatase, N-terminal domain [49364] (1 protein)
  6. 1299193Protein Purple acid phosphatase, N-terminal domain [49365] (2 species)
  7. 1299194Species Kidney bean (Phaseolus vulgaris) [TaxId:3885] [49366] (5 PDB entries)
  8. 1299201Domain d1kbpa1: 1kbp A:9-120 [22349]
    Other proteins in same PDB: d1kbpa2, d1kbpb2, d1kbpc2, d1kbpd2
    complexed with fe, nag, zn

Details for d1kbpa1

PDB Entry: 1kbp (more details), 2.65 Å

PDB Description: kidney bean purple acid phosphatase
PDB Compounds: (A:) purple acid phosphatase

SCOPe Domain Sequences for d1kbpa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kbpa1 b.1.12.1 (A:9-120) Purple acid phosphatase, N-terminal domain {Kidney bean (Phaseolus vulgaris) [TaxId: 3885]}
rdmpldsdvfrvppgynapqqvhitqgdlvgramiiswvtmdepgssavrywsekngrkr
iakgkmstyrffnyssgfihhttirklkyntkyyyevglrnttrrfsfitpp

SCOPe Domain Coordinates for d1kbpa1:

Click to download the PDB-style file with coordinates for d1kbpa1.
(The format of our PDB-style files is described here.)

Timeline for d1kbpa1: