Lineage for d4iy1b_ (4iy1 B:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2841375Family c.2.1.2: Tyrosine-dependent oxidoreductases [51751] (73 proteins)
    also known as short-chain dehydrogenases and SDR family
    parallel beta-sheet is extended by 7th strand, order 3214567; left-handed crossover connection between strands 6 and 7

    has additional subdomain(s) that are not in the common domain
  6. 2842913Protein automated matches [190085] (59 species)
    not a true protein
  7. 2843413Species Rhizobium radiobacter [TaxId:358] [197100] (3 PDB entries)
  8. 2843415Domain d4iy1b_: 4iy1 B: [223474]
    automated match to d4ixwa_
    complexed with cl; mutant

Details for d4iy1b_

PDB Entry: 4iy1 (more details), 2.1 Å

PDB Description: structure of a 37-fold mutant of halohydrin dehalogenase (hhec) with chloride bound
PDB Compounds: (B:) halohydrin dehalogenase

SCOPe Domain Sequences for d4iy1b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iy1b_ c.2.1.2 (B:) automated matches {Rhizobium radiobacter [TaxId: 358]}
staivtnvkhfggmgsalrlseaghtvachdesfkhqdeleafaetypqlipmseqepve
lieavtsalghvdilvsndiapvewrpidkyavedyrdmvealqikpfalanavasqmkr
rksghiifitsaasfgpwkelstyasaragasalanalskelgehnipvfaiapngvdsg
dspyyypsepwktspehvawvrkytalqrlgtqkelgelvtflasgscdyltgqvfwlag
gfpvverwpg

SCOPe Domain Coordinates for d4iy1b_:

Click to download the PDB-style file with coordinates for d4iy1b_.
(The format of our PDB-style files is described here.)

Timeline for d4iy1b_: