SCOPe 2.02: Domain d2mspg_: 2msp G:

Lineage for d2mspg_ (2msp G:)

1. Root: SCOPe 2.02

2. Class b: All beta proteins [48724] (174 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.11: PapD-like [49354] (2 families)
   contains PP switch between strands D and C'

5. Family b.1.11.2: MSP-like [49360] (4 proteins)
   Pfam PF00635

6. Protein Major sperm protein, MSP [49361] (2 species)

7. Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)

8. Domain d2mspg_: 2msp G: [22341]
   mutant

Details for d2mspg_

PDB Entry: 2msp, 3.3 Å

PDB Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5

PDB Compounds: (G:) major sperm protein

SCOPe Domain Sequences for d2mspg_:

Sequence; same for both SEQRES and ATOM records:

>d2mspg_ b.1.11.2 (G:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

Timeline for d2mspg_:

• d2mspg_ first appeared (with stable ids) in SCOP 1.55
  
• d2mspg_ appears in SCOPe 2.01
  
• d2mspg_ appears in SCOPe 2.03
  
• d2mspg_ appears in the current release, SCOPe 2.08