Lineage for d2mspg_ (2msp G:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 937239Superfamily b.1.11: PapD-like [49354] (2 families) (S)
    contains PP switch between strands D and C'
  5. 937306Family b.1.11.2: MSP-like [49360] (4 proteins)
    Pfam PF00635
  6. 937307Protein Major sperm protein, MSP [49361] (2 species)
  7. 937313Species Pig roundworm (Ascaris suum), alpha isoform [TaxId:6253] [49362] (4 PDB entries)
  8. 937326Domain d2mspg_: 2msp G: [22341]
    mutant

Details for d2mspg_

PDB Entry: 2msp (more details), 3.3 Å

PDB Description: major sperm protein, beta isoform, engineered c59s/t90c mutant, putative subfilament structure, ph 8.5
PDB Compounds: (G:) major sperm protein

SCOPe Domain Sequences for d2mspg_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2mspg_ b.1.11.2 (G:) Major sperm protein, MSP {Pig roundworm (Ascaris suum), alpha isoform [TaxId: 6253]}
svppgdintqpgskivfnapyddkhtyhikitnaggrrigwaikttnmrrlgvdppsgvl
dpsekvlmavscdtfnaatedlnndriciewtntpdgaakqfrrewfqgdgmvrrknlpi
eynl

SCOPe Domain Coordinates for d2mspg_:

Click to download the PDB-style file with coordinates for d2mspg_.
(The format of our PDB-style files is described here.)

Timeline for d2mspg_: