Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) |
Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
Protein automated matches [226922] (94 species) not a true protein |
Species Pseudomonas fluorescens [TaxId:205922] [226578] (1 PDB entry) |
Domain d4it1a1: 4it1 A:1-135 [223360] Other proteins in same PDB: d4it1a2, d4it1a3, d4it1b2, d4it1b3, d4it1c2, d4it1c3, d4it1d2, d4it1d3 automated match to d1ec7a2 complexed with bct, k, mg, tla |
PDB Entry: 4it1 (more details), 2.2 Å
SCOPe Domain Sequences for d4it1a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4it1a1 d.54.1.0 (A:1-135) automated matches {Pseudomonas fluorescens [TaxId: 205922]} mkitrvtvtpiafrdppllnasgihepfalrsiieiesdngyiglgesygdapalaiqqq vqsqligldpfnlnqlrrivqttvaahkpaslagaelapgshaskavsnaysafevafld lqarylnvplvdllg
Timeline for d4it1a1: