SCOPe 2.03: Domain d4it1a1: 4it1 A:-1-135

Lineage for d4it1a1 (4it1 A:-1-135)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families)

5. Family d.54.1.0: automated matches [227195] (1 protein)
   not a true family

6. Protein automated matches [226922] (55 species)
   not a true protein

7. Species Pseudomonas fluorescens [TaxId:205922] [226578] (1 PDB entry)

8. Domain d4it1a1: 4it1 A:-1-135 [223360]
   Other proteins in same PDB: d4it1a2, d4it1b2, d4it1c2, d4it1d2
   automated match to d1ec7a2
   complexed with bct, k, mg, tla

Details for d4it1a1

PDB Entry: 4it1, 2.2 Å

PDB Description: crystal structure of enolase pfl01_3283 (target efi-502286) from pseudomonas fluorescens pf0-1 with bound magnesium, potassium and tartrate

PDB Compounds: (A:) Putative glucarate dehydratase

SCOPe Domain Sequences for d4it1a1:

Sequence; same for both SEQRES and ATOM records:

>d4it1a1 d.54.1.0 (A:-1-135) automated matches {Pseudomonas fluorescens [TaxId: 205922]}
qsmkitrvtvtpiafrdppllnasgihepfalrsiieiesdngyiglgesygdapalaiq
qqvqsqligldpfnlnqlrrivqttvaahkpaslagaelapgshaskavsnaysafevaf
ldlqarylnvplvdllg

Timeline for d4it1a1:

• d4it1a1 is new in SCOPe 2.03-stable
  
• d4it1a1 appears in SCOPe 2.04
  
• d4it1a1 appears in the current release, SCOPe 2.08