| Class c: Alpha and beta proteins (a/b) [51349] (147 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (45 species) not a true protein |
| Species Pseudomonas fluorescens [TaxId:205922] [226580] (1 PDB entry) |
| Domain d4it1a2: 4it1 A:136-424 [223361] Other proteins in same PDB: d4it1a1, d4it1b1, d4it1c1, d4it1d1 automated match to d1ec7a1 complexed with bct, k, mg, tla |
PDB Entry: 4it1 (more details), 2.2 Å
SCOPe Domain Sequences for d4it1a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4it1a2 c.1.11.0 (A:136-424) automated matches {Pseudomonas fluorescens [TaxId: 205922]}
gavrdevpfsaylffkyaqhvdspykpdnwgealneqqivaqaarmieaygfksiklkag
tlppehevacikalkkafpgyplridpngnwsletsirmaellgddlqyyedptpglegm
aelhkrtglplatnmvvtdfdefrrsvaqnsvqivladhhywgglrdtqtlakmcdtfgl
gvsmhsnshlgislmamahvaaavpnldyacdthypwqepdeevikggklpivdgcvkit
rapglgleldhdqlgklhdqyltcgirqrddvrqmqrykpdwkalkprf
Timeline for d4it1a2: