Lineage for d4iiua_ (4iiu A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2846797Species Escherichia coli [TaxId:199310] [226553] (3 PDB entries)
  8. 2846799Domain d4iiua_: 4iiu A: [223207]
    automated match to d2c07a1
    complexed with nap

Details for d4iiua_

PDB Entry: 4iiu (more details), 2.1 Å

PDB Description: crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from escherichia coli strain cft073 complexed with nadp+ at 2.1 a resolution
PDB Compounds: (A:) 3-oxoacyl-[acyl-carrier protein] reductase

SCOPe Domain Sequences for d4iiua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4iiua_ c.2.1.0 (A:) automated matches {Escherichia coli [TaxId: 199310]}
msrsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfd
vanreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviq
pcimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnc
iapglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvising
gml

SCOPe Domain Coordinates for d4iiua_:

Click to download the PDB-style file with coordinates for d4iiua_.
(The format of our PDB-style files is described here.)

Timeline for d4iiua_: