PDB entry 4iiu

View 4iiu on RCSB PDB site
Description: Crystal structure of a putative 3-oxoacyl-[acyl-carrier protein]reductase from Escherichia coli strain CFT073 complexed with NADP+ at 2.1 A resolution
Class: oxidoreductase
Keywords: structural genomics, Center for Structural Genomics of Infectious Diseases, CSGID, short chain dehydrogenase, FabG, beta-ketoacyl-acyl carrier protein reductase, OXIDOREDUCTASE
Deposited on 2012-12-20, released 2013-01-09
The last revision prior to the SCOPe 2.07 freeze date was dated 2017-11-15, with a file datestamp of 2017-11-10.
Experiment type: XRAY
Resolution: 2.1 Å
R-factor: N/A
AEROSPACI score: 0.29 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:199310]
    Gene: c1187, NT04EC1225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FJ14 (24-266)
      • engineered mutation (43)
    Domains in SCOPe 2.07: d4iiua_
  • Chain 'B':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:199310]
    Gene: c1187, NT04EC1225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FJ14 (Start-266)
      • engineered mutation (43)
    Domains in SCOPe 2.07: d4iiub_
  • Chain 'C':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:199310]
    Gene: c1187, NT04EC1225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FJ14 (Start-266)
      • engineered mutation (43)
    Domains in SCOPe 2.07: d4iiuc_
  • Chain 'D':
    Compound: 3-oxoacyl-[acyl-carrier protein] reductase
    Species: Escherichia coli [TaxId:199310]
    Gene: c1187, NT04EC1225
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q8FJ14 (Start-266)
      • engineered mutation (43)
    Domains in SCOPe 2.07: d4iiud_
  • Heterogens: NAP, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4iiuA (A:)
    mhhhhhhssgvdlgtenlyfqsnamsrsvlvtgaskgigraiarqlaadgfnigvhyhrd
    aagaqetlnaivanggngrllsfdvanreqcrevleheiaqhgawygvvsnagiardaaf
    palsnddwdavihtnldsfynviqpcimpmigarqggriitlssvsgvmgnrgqvnysaa
    kagiigatkalaielakrkitvnciapglidtgmiemeesalkeamsmipmkrmgqaeev
    aglasylmsdiagyvtrqvisinggml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iiuA (A:)
    msrsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfd
    vanreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviq
    pcimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnc
    iapglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvising
    gml
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4iiuB (B:)
    mhhhhhhssgvdlgtenlyfqsnamsrsvlvtgaskgigraiarqlaadgfnigvhyhrd
    aagaqetlnaivanggngrllsfdvanreqcrevleheiaqhgawygvvsnagiardaaf
    palsnddwdavihtnldsfynviqpcimpmigarqggriitlssvsgvmgnrgqvnysaa
    kagiigatkalaielakrkitvnciapglidtgmiemeesalkeamsmipmkrmgqaeev
    aglasylmsdiagyvtrqvisinggml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iiuB (B:)
    srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
    anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
    cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
    apglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisingg
    ml
    

  • Chain 'C':
    Sequence, based on SEQRES records: (download)
    >4iiuC (C:)
    mhhhhhhssgvdlgtenlyfqsnamsrsvlvtgaskgigraiarqlaadgfnigvhyhrd
    aagaqetlnaivanggngrllsfdvanreqcrevleheiaqhgawygvvsnagiardaaf
    palsnddwdavihtnldsfynviqpcimpmigarqggriitlssvsgvmgnrgqvnysaa
    kagiigatkalaielakrkitvnciapglidtgmiemeesalkeamsmipmkrmgqaeev
    aglasylmsdiagyvtrqvisinggml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iiuC (C:)
    srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
    anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
    cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
    apglidtgmmeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisinggml
    

  • Chain 'D':
    Sequence, based on SEQRES records: (download)
    >4iiuD (D:)
    mhhhhhhssgvdlgtenlyfqsnamsrsvlvtgaskgigraiarqlaadgfnigvhyhrd
    aagaqetlnaivanggngrllsfdvanreqcrevleheiaqhgawygvvsnagiardaaf
    palsnddwdavihtnldsfynviqpcimpmigarqggriitlssvsgvmgnrgqvnysaa
    kagiigatkalaielakrkitvnciapglidtgmiemeesalkeamsmipmkrmgqaeev
    aglasylmsdiagyvtrqvisinggml
    

    Sequence, based on observed residues (ATOM records): (download)
    >4iiuD (D:)
    srsvlvtgaskgigraiarqlaadgfnigvhyhrdaagaqetlnaivanggngrllsfdv
    anreqcrevleheiaqhgawygvvsnagiardaafpalsnddwdavihtnldsfynviqp
    cimpmigarqggriitlssvsgvmgnrgqvnysaakagiigatkalaielakrkitvnci
    apglidtgmiemeesalkeamsmipmkrmgqaeevaglasylmsdiagyvtrqvisingg
    ml