SCOPe 2.08: Domain d4ibsb_: 4ibs B:

Lineage for d4ibsb_ (4ibs B:)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
   sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold

4. Superfamily b.2.5: p53-like transcription factors [49417] (8 families)

5. Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)

6. Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49420] (71 PDB entries)

8. Domain d4ibsb_: 4ibs B: [223103]
   automated match to d2ahia_
   complexed with edo, zn; mutant

Details for d4ibsb_

PDB Entry: 4ibs, 1.78 Å

PDB Description: human p53 core domain with hot spot mutation r273h (form i)

PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4ibsb_:

Sequence; same for both SEQRES and ATOM records:

>d4ibsb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevhvc
acpgrdrrteeenl

Timeline for d4ibsb_:

• d4ibsb_ first appeared in SCOPe 2.03
  
• d4ibsb_ appears in SCOPe 2.07