Lineage for d4ibsb_ (4ibs B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2376992Fold b.2: Common fold of diphtheria toxin/transcription factors/cytochrome f [49379] (9 superfamilies)
    sandwich; 9 strands in 2 sheet; greek-key; subclass of immunoglobin-like fold
  4. 2377721Superfamily b.2.5: p53-like transcription factors [49417] (8 families) (S)
  5. 2377722Family b.2.5.2: p53 DNA-binding domain-like [81314] (3 proteins)
  6. 2377723Protein p53 tumor suppressor, DNA-binding domain [49419] (2 species)
  7. 2377724Species Human (Homo sapiens) [TaxId:9606] [49420] (65 PDB entries)
  8. 2377818Domain d4ibsb_: 4ibs B: [223103]
    automated match to d2ahia_
    complexed with edo, zn; mutant

Details for d4ibsb_

PDB Entry: 4ibs (more details), 1.78 Å

PDB Description: human p53 core domain with hot spot mutation r273h (form i)
PDB Compounds: (B:) Cellular tumor antigen p53

SCOPe Domain Sequences for d4ibsb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4ibsb_ b.2.5.2 (B:) p53 tumor suppressor, DNA-binding domain {Human (Homo sapiens) [TaxId: 9606]}
svpsqktyqgsygfrlgflhsgtaksvtctyspalnkmfcqlaktcpvqlwvdstpppgt
rvramaiykqsqhmtevvrrcphhercsdsdglappqhlirvegnlrveylddrntfrhs
vvvpyeppevgsdcttihynymcnsscmggmnrrpiltiitledssgnllgrnsfevhvc
acpgrdrrteeenl

SCOPe Domain Coordinates for d4ibsb_:

Click to download the PDB-style file with coordinates for d4ibsb_.
(The format of our PDB-style files is described here.)

Timeline for d4ibsb_: