![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.9: CBD9-like [49344] (4 families) ![]() has additional strand at N-terminus; the active site in a similar topological location as the Cu,Zn SOD site |
![]() | Family b.1.9.1: Cytochrome domain of cellobiose dehydrogenase [49345] (1 protein) |
![]() | Protein Cytochrome domain of cellobiose dehydrogenase [49346] (1 species) |
![]() | Species Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId:5306] [49347] (4 PDB entries) |
![]() | Domain d1d7bb_: 1d7b B: [22308] complexed with 1pg, cd, hem |
PDB Entry: 1d7b (more details), 1.9 Å
SCOPe Domain Sequences for d1d7bb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1d7bb_ b.1.9.1 (B:) Cytochrome domain of cellobiose dehydrogenase {Basidomycetes fungus (Phanerochaete chrysosporium) [TaxId: 5306]} esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan yqnyln
Timeline for d1d7bb_: