Lineage for d1d7bb_ (1d7b B:)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 10215Superfamily b.1.9: Cytochrome domain of cellobiose dehydrogenase [49344] (1 family) (S)
  5. 10216Family b.1.9.1: Cytochrome domain of cellobiose dehydrogenase [49345] (1 protein)
  6. 10217Protein Cytochrome domain of cellobiose dehydrogenase [49346] (1 species)
  7. 10218Species Fungus (Phanerochaete chrysosporium) [TaxId:5306] [49347] (3 PDB entries)
  8. 10220Domain d1d7bb_: 1d7b B: [22308]

Details for d1d7bb_

PDB Entry: 1d7b (more details), 1.9 Å

PDB Description: cytochrome domain of cellobiose dehydrogenase, ph 7.5

SCOP Domain Sequences for d1d7bb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1d7bb_ b.1.9.1 (B:) Cytochrome domain of cellobiose dehydrogenase {Fungus (Phanerochaete chrysosporium)}
esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
yqnyln

SCOP Domain Coordinates for d1d7bb_:

Click to download the PDB-style file with coordinates for d1d7bb_.
(The format of our PDB-style files is described here.)

Timeline for d1d7bb_: