PDB entry 1d7b

View 1d7b on RCSB PDB site
Description: cytochrome domain of cellobiose dehydrogenase, ph 7.5
Class: oxidoreductase
Keywords: b-type cytochrome, met/his ligation, beta sandwich, fe(II)-protoporphyrin ix, oxidoreductase
Deposited on 1999-10-16, released 2000-10-18
The last revision prior to the SCOPe 2.07 freeze date was dated 2011-07-13, with a file datestamp of 2011-05-25.
Experiment type: XRAY
Resolution: 1.9 Å
R-factor: 0.192
AEROSPACI score: 0.46 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: cellobiose dehydrogenase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • GB AAC49277 (0-185)
      • engineered (0)
    Domains in SCOPe 2.07: d1d7ba_
  • Chain 'B':
    Compound: cellobiose dehydrogenase
    Species: Phanerochaete chrysosporium [TaxId:5306]
    Database cross-references and differences (RAF-indexed):
    • GB AAC49277 (0-185)
      • engineered (0)
    Domains in SCOPe 2.07: d1d7bb_
  • Heterogens: CD, HEM, 1PG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7bA (A:)
    esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
    lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
    cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
    yqnyln
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1d7bB (B:)
    esasqftdpttgfqftgitdpvhdvtygfvfpplatsgaqstefigevvapiaskwigia
    lggamnndlllvawangnqivsstrwatgyvqptaytgtatlttlpettinsthwkwvfr
    cqgctewnngggidvtsqgvlawafsnvavddpsdpqstfsehtdfgffgidystahsan
    yqnyln