SCOPe 2.08: Domain d4i9ng1: 4i9n G:1-159

Lineage for d4i9ng1 (4i9n G:1-159)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)

6. Protein automated matches [226881] (8 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (6 PDB entries)

8. Domain d4i9ng1: 4i9n G:1-159 [223062]
   Other proteins in same PDB: d4i9na2, d4i9nb2, d4i9nc2, d4i9nd2, d4i9ne2, d4i9nf2, d4i9ng2, d4i9nh2
   automated match to d9ldta1
   complexed with 1e5, 1e6

Details for d4i9ng1

PDB Entry: 4i9n, 2.35 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP28161 and AP28122

PDB Compounds: (G:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i9ng1:

Sequence, based on SEQRES records:

>d4i9ng1 c.2.1.5 (G:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records):

>d4i9ng1 c.2.1.5 (G:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqesrlnlvqrnvnifkfiipnv
vkysphckllvvsnpvdiltyvawkisgfpknrvig

Timeline for d4i9ng1:

• d4i9ng1 first appeared in SCOPe 2.03
  
• d4i9ng1 appears in SCOPe 2.07