Lineage for d4i9nf1 (4i9n F:1-159)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2844315Family c.2.1.5: LDH N-terminal domain-like [51848] (9 proteins)
  6. 2844864Protein automated matches [226881] (8 species)
    not a true protein
  7. 2844948Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225718] (6 PDB entries)
  8. 2844974Domain d4i9nf1: 4i9n F:1-159 [223060]
    Other proteins in same PDB: d4i9na2, d4i9nb2, d4i9nc2, d4i9nd2, d4i9ne2, d4i9nf2, d4i9ng2, d4i9nh2
    automated match to d9ldta1
    complexed with 1e5, 1e6

Details for d4i9nf1

PDB Entry: 4i9n (more details), 2.35 Å

PDB Description: Crystal structure of rabbit LDHA in complex with AP28161 and AP28122
PDB Compounds: (F:) L-lactate dehydrogenase A chain

SCOPe Domain Sequences for d4i9nf1:

Sequence, based on SEQRES records: (download)

>d4i9nf1 c.2.1.5 (F:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkeehvpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkge
mmdlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfii
pnvvkysphckllvvsnpvdiltyvawkisgfpknrvig

Sequence, based on observed residues (ATOM records): (download)

>d4i9nf1 c.2.1.5 (F:1-159) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aalkdqlihnllkevpqnkitvvgvgavgmacaisilmkdladelalvdvmedklkgemm
dlqhgslflrtpkivsgkdysvtansklviitagarqqegesrlnlvqrnvnifkfiipn
vvkysphckllvvsnpvdiltyvawkisgfpknrvig

SCOPe Domain Coordinates for d4i9nf1:

Click to download the PDB-style file with coordinates for d4i9nf1.
(The format of our PDB-style files is described here.)

Timeline for d4i9nf1: