Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) |
Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein) |
Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species) |
Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries) Uniprot P13702 4-377 |
Domain d4i6wb2: 4i6w B:611-720 [222965] Other proteins in same PDB: d4i6wa1, d4i6wb1 automated match to d1r31a1 complexed with 1co, gol, so4 |
PDB Entry: 4i6w (more details), 1.66 Å
SCOPe Domain Sequences for d4i6wb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4i6wb2 d.58.20.1 (B:611-720) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]} lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl
Timeline for d4i6wb2: