Lineage for d1r31a1 (1r31 A:111-220)
- Root: SCOPe 2.03
Class d: Alpha and beta proteins (a+b) [53931] (376 folds) 
Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) 
Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein) Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species) Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries)
Uniprot P13702 4-377
Domain d1r31a1: 1r31 A:111-220 [96897]
Other proteins in same PDB: d1r31a2, d1r31b2
complexed with coa, mev, so4
Details for d1r31a1
PDB Entry: 1r31 (more details), 2.1 Å
PDB Description: HMG-CoA reductase from Pseudomonas mevalonii complexed with HMG-CoA
PDB Compounds: (A:) 3-hydroxy-3-methylglutaryl-coenzyme A reductaseSCOPe Domain Sequences for d1r31a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r31a1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl
SCOPe Domain Coordinates for d1r31a1:
Click to download the PDB-style file with coordinates for d1r31a1.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1r31a1:
- d1r31a1 first appeared in SCOP 1.67
- d1r31a1 appears in SCOPe 2.02
- d1r31a1 appears in SCOPe 2.04
- d1r31a1 appears in the current release, SCOPe 2.08
View in 3D
