| Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
| Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.20: NAD-binding domain of HMG-CoA reductase [55035] (1 family) ![]() |
| Family d.58.20.1: NAD-binding domain of HMG-CoA reductase [55036] (1 protein) |
| Protein NAD-binding domain of HMG-CoA reductase [55037] (2 species) |
| Species Pseudomonas mevalonii [TaxId:32044] [55039] (11 PDB entries) Uniprot P13702 4-377 |
| Domain d1r31a1: 1r31 A:111-220 [96897] Other proteins in same PDB: d1r31a2, d1r31b2 complexed with coa, mev, so4 |
PDB Entry: 1r31 (more details), 2.1 Å
SCOPe Domain Sequences for d1r31a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1r31a1 d.58.20.1 (A:111-220) NAD-binding domain of HMG-CoA reductase {Pseudomonas mevalonii [TaxId: 32044]}
lmhaqvqivgiqdplnarlsllrrkdeiielanrkdqllnslgggcrdievhtfadtprg
pmlvahlivdvrdamgantvntmaeavaplmeaitggqvrlrilsnladl
Timeline for d1r31a1: