Lineage for d4i6jc1 (4i6j C:3-64)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1647422Fold d.42: POZ domain [54694] (1 superfamily)
    core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143
  4. 1647423Superfamily d.42.1: POZ domain [54695] (3 families) (S)
  5. 1647603Family d.42.1.0: automated matches [191460] (1 protein)
    not a true family
  6. 1647604Protein automated matches [190710] (3 species)
    not a true protein
  7. 1647605Species Human (Homo sapiens) [TaxId:9606] [187857] (21 PDB entries)
  8. 1647649Domain d4i6jc1: 4i6j C:3-64 [222959]
    Other proteins in same PDB: d4i6ja1, d4i6jc2
    automated match to d2ovra2

Details for d4i6jc1

PDB Entry: 4i6j (more details), 2.7 Å

PDB Description: A ubiquitin ligase-substrate complex
PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d4i6jc1:

Sequence, based on SEQRES records: (download)

>d4i6jc1 d.42.1.0 (C:3-64) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqwc
th

Sequence, based on observed residues (ATOM records): (download)

>d4i6jc1 d.42.1.0 (C:3-64) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siklqssdgeifevdveiakqsvtiktmledpvplpnvnaailkkviqwcth

SCOPe Domain Coordinates for d4i6jc1:

Click to download the PDB-style file with coordinates for d4i6jc1.
(The format of our PDB-style files is described here.)

Timeline for d4i6jc1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4i6jc2
View in 3D
Domains from other chains:
(mouse over for more information)
d4i6ja1