SCOPe 2.08: Domain d4i6jc1: 4i6j C:3-64

Lineage for d4i6jc1 (4i6j C:3-64)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.42: POZ domain [54694] (1 superfamily)
   core: beta(2)-alpha(2)-beta(2)-alpha(2); 2 layers a/b; mixed sheet: 2143

4. Superfamily d.42.1: POZ domain [54695] (3 families)

5. Family d.42.1.0: automated matches [191460] (1 protein)
   not a true family

6. Protein automated matches [190710] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187857] (54 PDB entries)

8. Domain d4i6jc1: 4i6j C:3-64 [222959]
   Other proteins in same PDB: d4i6ja1, d4i6jc2
   automated match to d2ovra2

Details for d4i6jc1

PDB Entry: 4i6j, 2.7 Å

PDB Description: A ubiquitin ligase-substrate complex

PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d4i6jc1:

Sequence, based on SEQRES records:

>d4i6jc1 d.42.1.0 (C:3-64) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siklqssdgeifevdveiakqsvtiktmledlgmddegdddpvplpnvnaailkkviqwc
th

Sequence, based on observed residues (ATOM records):

>d4i6jc1 d.42.1.0 (C:3-64) automated matches {Human (Homo sapiens) [TaxId: 9606]}
siklqssdgeifevdveiakqsvtiktmledpvplpnvnaailkkviqwcth

Timeline for d4i6jc1:

• d4i6jc1 first appeared in SCOPe 2.03
  
• d4i6jc1 appears in SCOPe 2.07