SCOPe 2.08: Domain d4i6jc2: 4i6j C:85-162

Lineage for d4i6jc2 (4i6j C:85-162)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.157: Skp1 dimerisation domain-like [81384] (1 superfamily)
   multihelical; interlocked heterodimer with F-box proteins

4. Superfamily a.157.1: Skp1 dimerisation domain-like [81382] (2 families)
   automatically mapped to Pfam PF01466

5. Family a.157.1.1: Skp1 dimerisation domain-like [81380] (3 proteins)

6. Protein automated matches [226933] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [225235] (12 PDB entries)

8. Domain d4i6jc2: 4i6j C:85-162 [222960]
   Other proteins in same PDB: d4i6ja1, d4i6jc1
   automated match to d1p22b1

Details for d4i6jc2

PDB Entry: 4i6j, 2.7 Å

PDB Description: A ubiquitin ligase-substrate complex

PDB Compounds: (C:) S-phase kinase-associated protein 1

SCOPe Domain Sequences for d4i6jc2:

Sequence; same for both SEQRES and ATOM records:

>d4i6jc2 a.157.1.1 (C:85-162) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ipvwdqeflkvdqgtlfelilaanyldikglldvtcktvanmikgktpeeirktfniknd
fteeeeaqvrkenqwcee

Timeline for d4i6jc2:

• d4i6jc2 first appeared in SCOPe 2.03
  
• d4i6jc2 appears in SCOPe 2.07