SCOPe 2.08: Domain d4hy4b1: 4hy4 B:254-346

Lineage for d4hy4b1 (4hy4 B:254-346)

1. Root: SCOPe 2.08

2. Class g: Small proteins [56992] (100 folds)

3. Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
   metal(zinc)-bound alpha+beta fold

4. Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families)

5. Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)

6. Protein automated matches [190700] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187840] (49 PDB entries)

8. Domain d4hy4b1: 4hy4 B:254-346 [222791]
   Other proteins in same PDB: d4hy4b2
   automated match to d3mupc_
   complexed with 1bg, zn

Details for d4hy4b1

PDB Entry: 4hy4, 1.25 Å

PDB Description: crystal structure of ciap1 bir3 bound to t3170284

PDB Compounds: (B:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4hy4b1:

Sequence; same for both SEQRES and ATOM records:

>d4hy4b1 g.52.1.1 (B:254-346) automated matches {Human (Homo sapiens) [TaxId: 9606]}
sisnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesg
ddpwvehakwfprceflirmkgqefvdeiqgry

Timeline for d4hy4b1:

• d4hy4b1 first appeared in SCOPe 2.03, called d4hy4b_
  
• d4hy4b1 appears in SCOPe 2.07