Lineage for d4hy4a_ (4hy4 A:)

  1. Root: SCOPe 2.07
  2. 2581248Class g: Small proteins [56992] (98 folds)
  3. 2589070Fold g.52: Inhibitor of apoptosis (IAP) repeat [57923] (1 superfamily)
    metal(zinc)-bound alpha+beta fold
  4. 2589071Superfamily g.52.1: Inhibitor of apoptosis (IAP) repeat [57924] (2 families) (S)
  5. 2589072Family g.52.1.1: Inhibitor of apoptosis (IAP) repeat [57925] (7 proteins)
  6. 2589206Protein automated matches [190700] (1 species)
    not a true protein
  7. 2589207Species Human (Homo sapiens) [TaxId:9606] [187840] (46 PDB entries)
  8. 2589210Domain d4hy4a_: 4hy4 A: [222790]
    Other proteins in same PDB: d4hy4b2
    automated match to d3mupc_
    complexed with 1bg, zn

Details for d4hy4a_

PDB Entry: 4hy4 (more details), 1.25 Å

PDB Description: crystal structure of ciap1 bir3 bound to t3170284
PDB Compounds: (A:) Baculoviral IAP repeat-containing protein 2

SCOPe Domain Sequences for d4hy4a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hy4a_ g.52.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
isnlsmqthaarmrtfmywpssvpvqpeqlasagfyyvgrnddvkcfccdgglrcwesgd
dpwvehakwfprceflirmkgqefvdeiqgry

SCOPe Domain Coordinates for d4hy4a_:

Click to download the PDB-style file with coordinates for d4hy4a_.
(The format of our PDB-style files is described here.)

Timeline for d4hy4a_: