Lineage for d4htla2 (4htl A:120-291)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1605035Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 1605036Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families) (S)
    duplication contains two domains of this fold
  5. 1606124Family c.55.1.0: automated matches [227137] (1 protein)
    not a true family
  6. 1606125Protein automated matches [226839] (42 species)
    not a true protein
  7. 1606354Species Listeria monocytogenes [TaxId:169963] [226530] (1 PDB entry)
  8. 1606356Domain d4htla2: 4htl A:120-291 [222744]
    automated match to d2gupa2
    complexed with edo

Details for d4htla2

PDB Entry: 4htl (more details), 1.64 Å

PDB Description: lmo2764 protein, a putative n-acetylmannosamine kinase, from listeria monocytogenes
PDB Compounds: (A:) Beta-glucoside kinase

SCOPe Domain Sequences for d4htla2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4htla2 c.55.1.0 (A:120-291) automated matches {Listeria monocytogenes [TaxId: 169963]}
lddflcltigtgigggifsngelvrggrfragefgymfserpgafrpgkytlnetttmlv
lrrqyaeltgrpleeitgeeifanydahdavserlitefytgictglynliylfdpthif
igggitsrptfiaelkhhmesfglrdtiietathknqagllgavyhflqeen

SCOPe Domain Coordinates for d4htla2:

Click to download the PDB-style file with coordinates for d4htla2.
(The format of our PDB-style files is described here.)

Timeline for d4htla2:

View in 3D
Domains from same chain:
(mouse over for more information)
d4htla1