SCOPe 2.04: Domain d4htla1: 4htl A:1-119

Lineage for d4htla1 (4htl A:1-119)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
   3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest

4. Superfamily c.55.1: Actin-like ATPase domain [53067] (16 families)
   duplication contains two domains of this fold

5. Family c.55.1.0: automated matches [227137] (1 protein)
   not a true family

6. Protein automated matches [226839] (42 species)
   not a true protein

7. Species Listeria monocytogenes [TaxId:169963] [226530] (1 PDB entry)

8. Domain d4htla1: 4htl A:1-119 [222743]
   automated match to d2gupa1
   complexed with edo

Details for d4htla1

PDB Entry: 4htl, 1.64 Å

PDB Description: lmo2764 protein, a putative n-acetylmannosamine kinase, from listeria monocytogenes

PDB Compounds: (A:) Beta-glucoside kinase

SCOPe Domain Sequences for d4htla1:

Sequence; same for both SEQRES and ATOM records:

>d4htla1 c.55.1.0 (A:1-119) automated matches {Listeria monocytogenes [TaxId: 169963]}
mkiaafdiggtalkmgvvlphgeiiltksaeisgsdgdqilaemkvflaentdvtgiavs
apgyvnpktglitmggairrfdnfnlkewleaetglpvaiendancallaekwlgkgqd

Timeline for d4htla1:

• d4htla1 first appeared in SCOPe 2.03
  
• d4htla1 appears in SCOPe 2.05
  
• d4htla1 appears in the current release, SCOPe 2.08