| Class b: All beta proteins [48724] (176 folds) |
| Fold b.42: beta-Trefoil [50352] (8 superfamilies) barrel, closed; n=6, S=12; and a hairpin triplet; meander duplication: has internal pseudo threefold symmetry |
Superfamily b.42.2: Ricin B-like lectins [50370] (4 families) ![]() |
| Family b.42.2.0: automated matches [227190] (1 protein) not a true family |
| Protein automated matches [226913] (8 species) not a true protein |
| Species Trichosanthes anguina [TaxId:50544] [226741] (1 PDB entry) |
| Domain d4hr6c2: 4hr6 C:134-264 [222719] automated match to d1rzob2 complexed with amg |
PDB Entry: 4hr6 (more details), 2.25 Å
SCOPe Domain Sequences for d4hr6c2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hr6c2 b.42.2.0 (C:134-264) automated matches {Trichosanthes anguina [TaxId: 50544]}
yvqpiigsivglddmcleatdgntnmwleecvpnkreqswalysdgtirvddnrelcvta
ssstydnwkvitilncdgsnnqrwvfladgsistpgnqrlamdvarsdvdlkkiilhrph
gdlnqqwvlfy
Timeline for d4hr6c2: