SCOPe 2.04: Domain d4hr6c1: 4hr6 C:1-133

Lineage for d4hr6c1 (4hr6 C:1-133)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.42: beta-Trefoil [50352] (8 superfamilies)
   barrel, closed; n=6, S=12; and a hairpin triplet; meander
   duplication: has internal pseudo threefold symmetry

4. Superfamily b.42.2: Ricin B-like lectins [50370] (4 families)

5. Family b.42.2.0: automated matches [227190] (1 protein)
   not a true family

6. Protein automated matches [226913] (8 species)
   not a true protein

7. Species Trichosanthes anguina [TaxId:50544] [226741] (1 PDB entry)

8. Domain d4hr6c1: 4hr6 C:1-133 [222718]
   automated match to d1rzob1
   complexed with amg

Details for d4hr6c1

PDB Entry: 4hr6, 2.25 Å

PDB Description: crystal structure of snake gourd (trichosanthes anguina) seed lectin, a three chain homologue of type ii rips

PDB Compounds: (C:) lectin

SCOPe Domain Sequences for d4hr6c1:

Sequence; same for both SEQRES and ATOM records:

>d4hr6c1 b.42.2.0 (C:1-133) automated matches {Trichosanthes anguina [TaxId: 50544]}
necivetrttrisgrdalcvdvagaltsdgsrlilypcgqqvnqkwtfhsdgtvrslgkc
latnnskfgnlvviydcsklaaediswdvsvggtimnpnyedlaltsnkatrstnltmev
ntysasqgwrvgn

Timeline for d4hr6c1:

• d4hr6c1 first appeared in SCOPe 2.03
  
• d4hr6c1 appears in SCOPe 2.05
  
• d4hr6c1 appears in the current release, SCOPe 2.08