Lineage for d1funj_ (1fun J:)

  1. Root: SCOP 1.59
  2. 101936Class b: All beta proteins [48724] (110 folds)
  3. 101937Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)
  4. 105752Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family) (S)
  5. 105753Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)
  6. 105766Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)
  7. 105822Species Human (Homo sapiens) [TaxId:9606] [49333] (7 PDB entries)
  8. 105844Domain d1funj_: 1fun J: [22268]

Details for d1funj_

PDB Entry: 1fun (more details), 2.85 Å

PDB Description: superoxide dismutase mutant with lys 136 replaced by glu, cys 6 replaced by ala and cys 111 replaced by ser (k136e, c6a, c111s)

SCOP Domain Sequences for d1funj_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1funj_ b.1.8.1 (J:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestetgnagsrlacgvigiaq

SCOP Domain Coordinates for d1funj_:

Click to download the PDB-style file with coordinates for d1funj_.
(The format of our PDB-style files is described here.)

Timeline for d1funj_: