SCOP 1.59: Domain d1func_: 1fun C:

Lineage for d1func_ (1fun C:)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.8: Cu,Zn superoxide dismutase-like [49329] (1 family)

5. Family b.1.8.1: Cu,Zn superoxide dismutase-like [49330] (2 proteins)

6. Protein Cu,Zn superoxide dismutase, SOD [49331] (9 species)

7. Species Human (Homo sapiens) [TaxId:9606] [49333] (7 PDB entries)

8. Domain d1func_: 1fun C: [22261]

Details for d1func_

PDB Entry: 1fun, 2.85 Å

PDB Description: superoxide dismutase mutant with lys 136 replaced by glu, cys 6 replaced by ala and cys 111 replaced by ser (k136e, c6a, c111s)

SCOP Domain Sequences for d1func_:

Sequence; same for both SEQRES and ATOM records:

>d1func_ b.1.8.1 (C:) Cu,Zn superoxide dismutase, SOD {Human (Homo sapiens)}
atkavavlkgdgpvqgiinfeqkesngpvkvwgsikglteglhgfhvhefgdntagctsa
gphfnplsrkhggpkdeerhvgdlgnvtadkdgvadvsiedsvislsgdhsiigrtlvvh
ekaddlgkggneestetgnagsrlacgvigiaq

Timeline for d1func_:

• d1func_ first appeared (with stable ids) in SCOP 1.55
  
• d1func_ appears in SCOP 1.57
  
• d1func_ appears in SCOP 1.61
  
• d1func_ appears in the current release, SCOPe 2.08