SCOPe 2.07: Domain d4hmra_: 4hmr A:

Lineage for d4hmra_ (4hmr A:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.6: Prion-like [54097] (1 superfamily)
   beta-alpha-beta-alpha(2); antiparallel beta-ribbon

4. Superfamily d.6.1: Prion-like [54098] (1 family)

5. Family d.6.1.1: Prion-like [54099] (3 protein domains)

6. Protein automated matches [191016] (9 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [226669] (6 PDB entries)

8. Domain d4hmra_: 4hmr A: [222675]
   automated match to d1fo7a_
   complexed with cl, gol, na; mutant

Details for d4hmra_

PDB Entry: 4hmr, 1.6 Å

PDB Description: Crystal structure of mutant rabbit PRP 121-230 (S170N/S174N)

PDB Compounds: (A:) major prion protein

SCOPe Domain Sequences for d4hmra_:

Sequence; same for both SEQRES and ATOM records:

>d4hmra_ d.6.1.1 (A:) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
ggymlgsamsrplihfgndyedryyrenmyrypnqvyyrpvdqynnqnnfvhdcvnitvk
qhtvttttkgenftetdikimervveqmcitqyqqesq

Timeline for d4hmra_:

• d4hmra_ first appeared in SCOPe 2.03
  
• d4hmra_ appears in SCOPe 2.06