SCOPe 2.08: Domain d4hgwa1: 4hgw A:1-107

Lineage for d4hgwa1 (4hgw A:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)

6. Protein Immunoglobulin light chain kappa variable domain, VL-kappa [88519] (16 species)
   VL-kappa domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VL-kappa domains with artificial or grafted exogenous CDRs are listed as engineered species

7. Species Mouse (Mus musculus), cluster 1.2 [TaxId:10090] [88525] (52 PDB entries)

8. Domain d4hgwa1: 4hgw A:1-107 [222598]
   Other proteins in same PDB: d4hgwa2, d4hgwb1, d4hgwb2
   automated match to d3t65a1
   complexed with zn

Details for d4hgwa1

PDB Entry: 4hgw, 1.65 Å

PDB Description: crystal structure of s25-2 in complex with a 5,6-dehydro-kdo disaccharide

PDB Compounds: (A:) antibody fab fragment, light chain

SCOPe Domain Sequences for d4hgwa1:

Sequence; same for both SEQRES and ATOM records:

>d4hgwa1 b.1.1.1 (A:1-107) Immunoglobulin light chain kappa variable domain, VL-kappa {Mouse (Mus musculus), cluster 1.2 [TaxId: 10090]}
divmsqspsslavsagekvtmsckssqsllnsrtrknylawyqqkpgqspklliywastr
esgvpdrftgsgsgtdftltitsvqaedlavyyckqsynlrtfgggtkleikr

Timeline for d4hgwa1:

• d4hgwa1 first appeared in SCOPe 2.03
  
• d4hgwa1 appears in SCOPe 2.07