Lineage for d4hgwb1 (4hgw B:1-112)

  1. Root: SCOPe 2.06
  2. 2017114Class b: All beta proteins [48724] (177 folds)
  3. 2017115Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2017116Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2017117Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 protein domains)
  6. 2017323Protein Immunoglobulin heavy chain variable domain, VH [88543] (21 species)
    VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species
  7. 2017580Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries)
    Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4
  8. 2017587Domain d4hgwb1: 4hgw B:1-112 [222600]
    Other proteins in same PDB: d4hgwa1, d4hgwa2, d4hgwb2
    automated match to d3t65b1
    complexed with zn

Details for d4hgwb1

PDB Entry: 4hgw (more details), 1.65 Å

PDB Description: Crystal structure of S25-2 in complex with a 5,6-dehydro-Kdo disaccharide
PDB Compounds: (B:) antibody fab fragment, heavy chain

SCOPe Domain Sequences for d4hgwb1:

Sequence, based on SEQRES records: (download)

>d4hgwb1 b.1.1.1 (B:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv
sa

Sequence, based on observed residues (ATOM records): (download)

>d4hgwb1 b.1.1.1 (B:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]}
evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt
eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfswgqgtlvtvs
a

SCOPe Domain Coordinates for d4hgwb1:

Click to download the PDB-style file with coordinates for d4hgwb1.
(The format of our PDB-style files is described here.)

Timeline for d4hgwb1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hgwb2