![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins) |
![]() | Protein Immunoglobulin heavy chain variable domain, VH [88543] (22 species) VH domains of human and mouse antibodies are clustered by the sequence similarity within the germline encoded segment and then by the size of the complementarity determining regions CDR1 and CDR2, so the clusters may correspond to putative germline families in the species genomes; VH domains with artificial or grafted exogenous CDRs are listed as engineered species |
![]() | Species Mouse (Mus musculus), cluster 1 [TaxId:10090] [88548] (68 PDB entries) Uniprot P01796 # ! HV27_MOUSE Ig heavy chain V-III region A4 |
![]() | Domain d4hgwb1: 4hgw B:1-112 [222600] Other proteins in same PDB: d4hgwa1, d4hgwa2, d4hgwb2 automated match to d3t65b1 complexed with zn |
PDB Entry: 4hgw (more details), 1.65 Å
SCOPe Domain Sequences for d4hgwb1:
Sequence, based on SEQRES records: (download)
>d4hgwb1 b.1.1.1 (B:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfsywgqgtlvtv sa
>d4hgwb1 b.1.1.1 (B:1-112) Immunoglobulin heavy chain variable domain, VH {Mouse (Mus musculus), cluster 1 [TaxId: 10090]} evklvesggglvqsggslrlscatsgftftdyymswvrqppgkalewlgfirnkangytt eyspsvkgrftisrdnsqsilylqmntlraedsatyycardhdgyyerfswgqgtlvtvs a
Timeline for d4hgwb1: