Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
Family c.1.11.2: D-glucarate dehydratase-like [51609] (14 proteins) |
Protein automated matches [226997] (7 species) not a true protein |
Species Agrobacterium tumefaciens [TaxId:176299] [226506] (4 PDB entries) |
Domain d4hcla2: 4hcl A:127-382 [222503] Other proteins in same PDB: d4hcla1, d4hclb1 automated match to d1rvka1 complexed with llh, mg, pg4 |
PDB Entry: 4hcl (more details), 1.8 Å
SCOPe Domain Sequences for d4hcla2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hcla2 c.1.11.2 (A:127-382) automated matches {Agrobacterium tumefaciens [TaxId: 176299]} yrdkvlaygsimcgdelegglatpedygrfaetlvkrgykgiklhtwmppvswapdvkmd lkacaavreavgpdirlmidafhwysrtdalalgrgleklgfdwieepmdeqslssykwl sdnldipvvgpesaagkhwhraewikagacdilrtgvndvggitpalktmhlaeafgmec evhgntamnlhvvaatkncrwyergllhpfleyddghdylkslsdpmdrdgfvhvpdrpg lgedidftfidnnrvr
Timeline for d4hcla2: