| Class d: Alpha and beta proteins (a+b) [53931] (380 folds) |
| Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily) beta(3)-alpha(3); meander and up-and-down bundle |
Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) ![]() |
| Family d.54.1.0: automated matches [227195] (1 protein) not a true family |
| Protein automated matches [226922] (67 species) not a true protein |
| Species Agrobacterium tumefaciens [TaxId:176299] [226505] (6 PDB entries) |
| Domain d4hcla1: 4hcl A:-1-126 [222502] Other proteins in same PDB: d4hcla2, d4hclb2 automated match to d1rvka2 complexed with llh, mg, pg4 |
PDB Entry: 4hcl (more details), 1.8 Å
SCOPe Domain Sequences for d4hcla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hcla1 d.54.1.0 (A:-1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
pvykligg
Timeline for d4hcla1: