Lineage for d4hcla1 (4hcl A:-1-126)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1649013Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 1649014Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 1649263Family d.54.1.0: automated matches [227195] (1 protein)
    not a true family
  6. 1649264Protein automated matches [226922] (67 species)
    not a true protein
  7. 1649285Species Agrobacterium tumefaciens [TaxId:176299] [226505] (6 PDB entries)
  8. 1649291Domain d4hcla1: 4hcl A:-1-126 [222502]
    Other proteins in same PDB: d4hcla2, d4hclb2
    automated match to d1rvka2
    complexed with llh, mg, pg4

Details for d4hcla1

PDB Entry: 4hcl (more details), 1.8 Å

PDB Description: crystal structure of d-glucarate dehydratase from agrobacterium tumefaciens complexed with magnesium and l-lyxarohydroxamate
PDB Compounds: (A:) isomerase/lactonizing enzyme

SCOPe Domain Sequences for d4hcla1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hcla1 d.54.1.0 (A:-1-126) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
shmiitdvevrvfrtttrrhsdsaghahpgpahqveqamltvrtedgqeghsftapeivr
phviekfvkkvligedhrdrerlwqdlahwqrgsaaqltdrtlavvdcalwdlagrslgq
pvykligg

SCOPe Domain Coordinates for d4hcla1:

Click to download the PDB-style file with coordinates for d4hcla1.
(The format of our PDB-style files is described here.)

Timeline for d4hcla1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4hcla2