Lineage for d4hbqb2 (4hbq B:91-202)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2364875Family b.1.1.4: I set domains [49159] (39 proteins)
  6. 2365289Protein automated matches [190803] (3 species)
    not a true protein
  7. 2365290Species Human (Homo sapiens) [TaxId:9606] [188070] (28 PDB entries)
  8. 2365292Domain d4hbqb2: 4hbq B:91-202 [222487]
    Other proteins in same PDB: d4hbqa1, d4hbqa3, d4hbqb1, d4hbqb3
    automated match to d1bqsa2
    complexed with gol, nag, so4; mutant

Details for d4hbqb2

PDB Entry: 4hbq (more details), 1.4 Å

PDB Description: crystal structure of a loop deleted mutant of human madcam-1 d1d2
PDB Compounds: (B:) Mucosal addressin cell adhesion molecule 1

SCOPe Domain Sequences for d4hbqb2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hbqb2 b.1.1.4 (B:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]}
afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqqep
iggdvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl

SCOPe Domain Coordinates for d4hbqb2:

Click to download the PDB-style file with coordinates for d4hbqb2.
(The format of our PDB-style files is described here.)

Timeline for d4hbqb2: