Class b: All beta proteins [48724] (178 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.4: I set domains [49159] (39 proteins) |
Protein automated matches [190803] (3 species) not a true protein |
Species Human (Homo sapiens) [TaxId:9606] [188070] (28 PDB entries) |
Domain d4hbqb2: 4hbq B:91-202 [222487] Other proteins in same PDB: d4hbqa1, d4hbqa3, d4hbqb1, d4hbqb3 automated match to d1bqsa2 complexed with gol, nag, so4; mutant |
PDB Entry: 4hbq (more details), 1.4 Å
SCOPe Domain Sequences for d4hbqb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hbqb2 b.1.1.4 (B:91-202) automated matches {Human (Homo sapiens) [TaxId: 9606]} afpnqltvspaalvpgdpevactahkvtpvdpnalsfsllvggqelegaqalgpevqqep iggdvlfrvterwrlpplgtpvppalycqatmrlpglelshrqaipvl
Timeline for d4hbqb2: