PDB entry 4hbq

View 4hbq on RCSB PDB site
Description: Crystal structure of a loop deleted mutant of Human MAdCAM-1 D1D2
Class: immune system
Keywords: immunoglobulin superfamily, integrin alpha4beta7, IMMUNE SYSTEM
Deposited on 2012-09-28, released 2013-01-23
The last revision prior to the SCOPe 2.07 freeze date was dated 2013-01-23, with a file datestamp of 2013-01-18.
Experiment type: XRAY
Resolution: 1.4 Å
R-factor: 0.144
AEROSPACI score: 0.63 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: Mucosal addressin cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MADCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (0-197)
      • engineered mutation (93)
      • engineered mutation (147)
      • insertion (149-152)
      • expression tag (198-205)
    Domains in SCOPe 2.07: d4hbqa1, d4hbqa2, d4hbqa3
  • Chain 'B':
    Compound: Mucosal addressin cell adhesion molecule 1
    Species: Homo sapiens [TaxId:9606]
    Gene: MADCAM1
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q13477 (0-197)
      • engineered mutation (93)
      • engineered mutation (147)
      • insertion (149-152)
      • expression tag (198-205)
    Domains in SCOPe 2.07: d4hbqb1, d4hbqb2, d4hbqb3
  • Heterogens: SO4, GOL, NAG, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hbqA (A:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqqepiggdvlfrvterwrlpplgtpvppalycqa
    tmrlpglelshrqaipvlggenlyfq
    

  • Chain 'B':
    Sequence; same for both SEQRES and ATOM records: (download)
    >4hbqB (B:)
    vkplqveppepvvavalgasrqltcrlacadrgasvqwrgldtslgavqsdtgrsvltvr
    naslsaagtrvcvgscggrtfqhtvqllvyafpnqltvspaalvpgdpevactahkvtpv
    dpnalsfsllvggqelegaqalgpevqqepiggdvlfrvterwrlpplgtpvppalycqa
    tmrlpglelshrqaipvlggenlyfq