Lineage for d4hawb_ (4haw B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803715Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries)
  8. 2803729Domain d4hawb_: 4haw B: [222464]
    Other proteins in same PDB: d4hawa_
    automated match to d4hb3b_
    complexed with cl, edo, gnp, gol, lmb, mg

Details for d4hawb_

PDB Entry: 4haw (more details), 1.9 Å

PDB Description: crystal structure of crm1 inhibitor leptomycin b in complex with crm1(k548a)-ran-ranbp1
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d4hawb_:

Sequence, based on SEQRES records: (download)

>d4hawb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvhlekvdvktmeedeevlykvraklfrfdkdakewkergtgdckflknkktnkv
rilmrrdktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgske
nadkfkeefekaqeinkk

Sequence, based on observed residues (ATOM records): (download)

>d4hawb_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
ihfepvvktmeedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrd
ktlkicanhiiapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfke
efekaqeinkk

SCOPe Domain Coordinates for d4hawb_:

Click to download the PDB-style file with coordinates for d4hawb_.
(The format of our PDB-style files is described here.)

Timeline for d4hawb_: