Lineage for d4hb3b_ (4hb3 B:)
- Root: SCOPe 2.08
Class b: All beta proteins [48724] (180 folds) 
Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helixSuperfamily b.55.1: PH domain-like [50729] (14 families) 
Family b.55.1.0: automated matches [191311] (1 protein)
not a true familyProtein automated matches [190052] (8 species)
not a true protein
Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries) 
Domain d4hb3b_: 4hb3 B: [197018]
Other proteins in same PDB: d4hb3a_
automated match to d1k5db_
complexed with cl, gnp, mg
Details for d4hb3b_
PDB Entry: 4hb3 (more details), 2.8 Å
PDB Description: crystal structure of crm1(t539s)-ran-ranbp1 with weakly bound unmodeled leptomycin b
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1SCOPe Domain Sequences for d4hb3b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4hb3b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrdktlkicanhi
iapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeink
k
SCOPe Domain Coordinates for d4hb3b_:
Click to download the PDB-style file with coordinates for d4hb3b_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d4hb3b_:
- d4hb3b_ first appeared in SCOPe 2.02
- d4hb3b_ appears in SCOPe 2.07
View in 3D
