Lineage for d4hb3b_ (4hb3 B:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2803065Fold b.55: PH domain-like barrel [50728] (3 superfamilies)
    barrel, partly opened; n*=6, S*=12; meander; capped by an alpha-helix
  4. 2803066Superfamily b.55.1: PH domain-like [50729] (14 families) (S)
  5. 2803713Family b.55.1.0: automated matches [191311] (1 protein)
    not a true family
  6. 2803714Protein automated matches [190052] (8 species)
    not a true protein
  7. 2803715Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [194506] (63 PDB entries)
  8. 2803776Domain d4hb3b_: 4hb3 B: [197018]
    Other proteins in same PDB: d4hb3a_
    automated match to d1k5db_
    complexed with cl, gnp, mg

Details for d4hb3b_

PDB Entry: 4hb3 (more details), 2.8 Å

PDB Description: crystal structure of crm1(t539s)-ran-ranbp1 with weakly bound unmodeled leptomycin b
PDB Compounds: (B:) Ran-specific GTPase-activating protein 1

SCOPe Domain Sequences for d4hb3b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4hb3b_ b.55.1.0 (B:) automated matches {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
eedeevlykvraklfrfdkdakewkergtgdckflknkktnkvrilmrrdktlkicanhi
iapeytlkpnvgsdrswvyactadiaegeaeaftfairfgskenadkfkeefekaqeink
k

SCOPe Domain Coordinates for d4hb3b_:

Click to download the PDB-style file with coordinates for d4hb3b_.
(The format of our PDB-style files is described here.)

Timeline for d4hb3b_: