| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
| Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
| Protein automated matches [190069] (203 species) not a true protein |
| Species Leishmania major [TaxId:347515] [226495] (2 PDB entries) |
| Domain d4h7pa1: 4h7p A:1-155 [222421] Other proteins in same PDB: d4h7pa2, d4h7pb2 automated match to d1civa1 complexed with so4 |
PDB Entry: 4h7p (more details), 1.3 Å
SCOPe Domain Sequences for d4h7pa1:
Sequence; same for both SEQRES and ATOM records: (download)
>d4h7pa1 c.2.1.0 (A:1-155) automated matches {Leishmania major [TaxId: 347515]}
msavkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeledca
fplldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaavaa
sdcrvvvvgnpantnalillksaqgklnprhvtam
Timeline for d4h7pa1: