Lineage for d4h7pa1 (4h7p A:1-155)

  1. Root: SCOPe 2.05
  2. 1815291Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1826588Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1826589Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1830524Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1830525Protein automated matches [190069] (203 species)
    not a true protein
  7. 1831521Species Leishmania major [TaxId:347515] [226495] (2 PDB entries)
  8. 1831522Domain d4h7pa1: 4h7p A:1-155 [222421]
    Other proteins in same PDB: d4h7pa2, d4h7pb2
    automated match to d1civa1
    complexed with so4

Details for d4h7pa1

PDB Entry: 4h7p (more details), 1.3 Å

PDB Description: Crystal structure of a putative Cytosolic malate dehydrogenase from Leishmania major Friedlin
PDB Compounds: (A:) malate dehydrogenase

SCOPe Domain Sequences for d4h7pa1:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h7pa1 c.2.1.0 (A:1-155) automated matches {Leishmania major [TaxId: 347515]}
msavkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeledca
fplldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaavaa
sdcrvvvvgnpantnalillksaqgklnprhvtam

SCOPe Domain Coordinates for d4h7pa1:

Click to download the PDB-style file with coordinates for d4h7pa1.
(The format of our PDB-style files is described here.)

Timeline for d4h7pa1:

View in 3D
Domains from same chain:
(mouse over for more information)
d4h7pa2