PDB entry 4h7p

View 4h7p on RCSB PDB site
Description: Crystal structure of a putative Cytosolic malate dehydrogenase from Leishmania major Friedlin
Class: oxidoreductase
Keywords: SSGCID, Leishmania major, Malate dehydrogenase, Structural Genomics, Seattle Structural Genomics Center for Infectious Disease, OXIDOREDUCTASE
Deposited on 2012-09-20, released 2012-10-10
The last revision prior to the SCOPe 2.05 freeze date was dated 2012-10-10, with a file datestamp of 2012-10-05.
Experiment type: XRAY
Resolution: 1.3 Å
R-factor: 0.153
AEROSPACI score: 0.78 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: malate dehydrogenase
    Species: Leishmania major [TaxId:347515]
    Gene: cMDH, LMJF_28_2860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h7pa1, d4h7pa2
  • Chain 'B':
    Compound: malate dehydrogenase
    Species: Leishmania major [TaxId:347515]
    Gene: cMDH, LMJF_28_2860
    Database cross-references and differences (RAF-indexed): Domains in SCOPe 2.05: d4h7pb1, d4h7pb2
  • Heterogens: SO4, HOH

PDB Chain Sequences:

  • Chain 'A':
    Sequence, based on SEQRES records: (download)
    >4h7pA (A:)
    mahhhhhhmgtleaqtqgpgsmsavkvavtgaagqigyalvpliargallgpttpvelrl
    ldiepalkalagveaeledcafplldkvvvtadprvafdgvaiaimcgafprkagmerkd
    llemnarifkeqgeaiaavaasdcrvvvvgnpantnalillksaqgklnprhvtamtrld
    hnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpareaikddaldddfv
    qvvrgrgaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygvpsgl
    ifsfpctchagewtvvsgklngdlgkqrlastiaelqeeraqagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h7pA (A:)
    msavkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeledca
    fplldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaavaa
    sdcrvvvvgnpantnalillksaqgklnprhvtamtrldhnralsllarkagvpvsqvrn
    viiwgnhsstqvpdtdsavigttpareaikdfvqvvrgrgaeiiqlrglssamsaakaav
    dhvhdwihgtpegvyvsmgvysdenpygvpsglifsfpctchagewtvvsgklkqrlast
    iaelqeeraqagl
    

  • Chain 'B':
    Sequence, based on SEQRES records: (download)
    >4h7pB (B:)
    mahhhhhhmgtleaqtqgpgsmsavkvavtgaagqigyalvpliargallgpttpvelrl
    ldiepalkalagveaeledcafplldkvvvtadprvafdgvaiaimcgafprkagmerkd
    llemnarifkeqgeaiaavaasdcrvvvvgnpantnalillksaqgklnprhvtamtrld
    hnralsllarkagvpvsqvrnviiwgnhsstqvpdtdsavigttpareaikddaldddfv
    qvvrgrgaeiiqlrglssamsaakaavdhvhdwihgtpegvyvsmgvysdenpygvpsgl
    ifsfpctchagewtvvsgklngdlgkqrlastiaelqeeraqagl
    

    Sequence, based on observed residues (ATOM records): (download)
    >4h7pB (B:)
    savkvavtgaagqigyalvpliargallgpttpvelrlldiepalkalagveaeledcaf
    plldkvvvtadprvafdgvaiaimcgafprkagmerkdllemnarifkeqgeaiaavaas
    dcrvvvvgnpantnalillksaqgklnprhvtamtrldhnralsllarkagvpvsqvrnv
    iiwgnhsstqvpdtdsavigttpdfvqvvrgrgaeiiqlrglssamsaakaavdhvhdwi
    hgtpegvyvsmgvysdenpygvpsglifsfpctchagewtvvsgklkqrlastiaelqee
    raqagl