Lineage for d4h31c2 (4h31 C:153-334)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1620378Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1620379Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1620829Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 1620830Protein automated matches [226938] (22 species)
    not a true protein
  7. 1621003Species Vibrio vulnificus [TaxId:216895] [226484] (6 PDB entries)
  8. 1621009Domain d4h31c2: 4h31 C:153-334 [222354]
    automated match to d1duvg2
    complexed with cl, cp, nva, pe5, peg

Details for d4h31c2

PDB Entry: 4h31 (more details), 1.7 Å

PDB Description: crystal structure of anabolic ornithine carbamoyltransferase from vibrio vulnificus in complex with carbamoyl phosphate and l-norvaline
PDB Compounds: (C:) ornithine carbamoyltransferase

SCOPe Domain Sequences for d4h31c2:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h31c2 c.78.1.0 (C:153-334) automated matches {Vibrio vulnificus [TaxId: 216895]}
kaladiqfaylgdarnnvgnslmvgaakmgmdirlvgpqaywpdeelvaacqaiakqtgg
kitltenvaegvqgcdflytdvwvsmgespeawdervalmkpyqvnmnvlkqtgnpnvkf
mhclpafhndettigkqvadkfgmkglevteevfesehsivfdeaenrmhtikavmvatl
gs

SCOPe Domain Coordinates for d4h31c2:

Click to download the PDB-style file with coordinates for d4h31c2.
(The format of our PDB-style files is described here.)

Timeline for d4h31c2: