Lineage for d4h2wc_ (4h2w C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1731061Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
    4 helices, bundle; helix 3 is shorter than others; up-and-down
  4. 1731062Superfamily a.28.1: ACP-like [47336] (4 families) (S)
  5. 1731063Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)
  6. 1731122Protein automated matches [190286] (8 species)
    not a true protein
  7. 1731123Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries)
  8. 1731124Domain d4h2wc_: 4h2w C: [222342]
    automated match to d2jq4a1
    protein/RNA complex; complexed with 5gp, amp, cl, pns, zn

Details for d4h2wc_

PDB Entry: 4h2w (more details), 1.95 Å

PDB Description: crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp
PDB Compounds: (C:) Aminoacyl carrier protein

SCOPe Domain Sequences for d4h2wc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d4h2wc_ a.28.1.1 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
hmnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnlln
rksfasikaiedtvklil

SCOPe Domain Coordinates for d4h2wc_:

Click to download the PDB-style file with coordinates for d4h2wc_.
(The format of our PDB-style files is described here.)

Timeline for d4h2wc_: