SCOPe 2.04: Domain d4h2wc_: 4h2w C:

Lineage for d4h2wc_ (4h2w C:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.28: Acyl carrier protein-like [47335] (3 superfamilies)
   4 helices, bundle; helix 3 is shorter than others; up-and-down

4. Superfamily a.28.1: ACP-like [47336] (4 families)

5. Family a.28.1.1: Acyl-carrier protein (ACP) [47337] (7 proteins)

6. Protein automated matches [190286] (8 species)
   not a true protein

7. Species Agrobacterium tumefaciens [TaxId:176299] [226607] (3 PDB entries)

8. Domain d4h2wc_: 4h2w C: [222342]
   automated match to d2jq4a1
   protein/RNA complex; complexed with 5gp, amp, cl, pns, zn

Details for d4h2wc_

PDB Entry: 4h2w, 1.95 Å

PDB Description: crystal structure of engineered bradyrhizobium japonicum glycine:[carrier protein] ligase complexed with carrier protein from agrobacterium tumefaciens and amp

PDB Compounds: (C:) Aminoacyl carrier protein

SCOPe Domain Sequences for d4h2wc_:

Sequence; same for both SEQRES and ATOM records:

>d4h2wc_ a.28.1.1 (C:) automated matches {Agrobacterium tumefaciens [TaxId: 176299]}
hmnatireilakfgqlptpvdtiadeadlyaaglssfasvqlmlgieeafdiefpdnlln
rksfasikaiedtvklil

Timeline for d4h2wc_:

• d4h2wc_ first appeared in SCOPe 2.03
  
• d4h2wc_ appears in SCOPe 2.05
  
• d4h2wc_ appears in the current release, SCOPe 2.08, called d4h2wc1